DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and Y65B4A.9

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001293249.1 Gene:Y65B4A.9 / 171658 WormBaseID:WBGene00022032 Length:391 Species:Caenorhabditis elegans


Alignment Length:450 Identity:83/450 - (18%)
Similarity:158/450 - (35%) Gaps:143/450 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 NGTILRDVLSKAWRLGRPIGKGNFGEIFLASDDTVCPASSETAKYVVKIEPHSNGPLFVEIHCLI 175
            |||         :.:.:|:..|.||.|:                   |::..|:|..|. :.|..
 Worm    18 NGT---------YEVTKPLATGTFGSIY-------------------KVKRESDGKFFA-VKCEA 53

  Fly   176 NTSRNNDLSDAAEDAASLPAPQ---THVLSRGPPSGIPSFIASGTHYFGDVRYRFLVLPRFDRDL 237
            ...:::.|...:...||:..|.   |::..||.   :|:            |:.|:|:|.:..:|
 Worm    54 LNMKSSLLRQMSVVLASIHHPSPFFTNIEERGT---VPN------------RFLFIVMPLYGENL 103

  Fly   238 HSLIKNSRVQQKSLLVLAVHI----INVLENLHDKGYCHNDIKAQNLMVSK-------------- 284
            :.|:.|:...:|..:...:|:    :..:.:||..|:.|.|||..:..:.:              
 Worm   104 YELMMNTNKDRKFSMATGLHLAEQTLAAIRDLHRNGFIHRDIKPSHFCIGREIDGQHHQVYLLDF 168

  Fly   285 --CKYLRRQVVPKGNGYED-------HYE--EKQQTTDSGNSSEQETNDD---------DYFLKS 329
              ||  |.:.|.|.:..|:       ||.  .|..:..:.........||         ::||.:
 Worm   169 GLCK--RPRFVKKNDEAEEQMRKNAIHYRGVVKYASVHAHQGKNLGYKDDMESWWYMVLEFFLGA 231

  Fly   330 EKFALKKIVDIKQDEDEDDEDFDDGATSNSNNSNSLDVFHTPVNKKRSARNAIQFSGSNPVRACR 394
            ..:||                        .|..:..||.|  :.::.:|........:.|     
 Worm   232 LPWAL------------------------LNKESEQDVLH--LKRRITAPMVASVWRTTP----- 265

  Fly   395 REKRNSMYEEMVKSHYLRPTKRISYREEFNE--DGYPK--ETAENSDESPESSDNESD------- 448
             |.....::.:.   .:|..|.::...|::.  ||..|  |.::::.:.|...|..:|       
 Worm   266 -ETTAGFFDLLT---IIREPKDVAEFVEYDRIADGIQKLFEKSKSNTQEPPDWDCMTDYKGPGYQ 326

  Fly   449 ---EFIPPS-SRRSVIKRGRSAQIA------TPKKTPVSTRASRQEKVKKEPNGDQKLRS 498
               ...||. ..:..:..|:|...|      .|||..|..:..:::|.||:...:.|..|
 Worm   327 QVLMIAPPEVGLKPEMDFGKSDPGAGGESGEQPKKEDVDKKKKKKKKSKKKGKSNNKTTS 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357 36/196 (18%)
SPS1 123..>284 CDD:223589 34/167 (20%)
SPS1 <491..756 CDD:223589 1/7 (14%)
PKc_like <517..652 CDD:304357
Y65B4A.9NP_001293249.1 STKc_TTBK 20..302 CDD:270919 63/362 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.