DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and CSNK1E

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001885.1 Gene:CSNK1E / 1454 HGNCID:2453 Length:416 Species:Homo sapiens


Alignment Length:765 Identity:132/765 - (17%)
Similarity:203/765 - (26%) Gaps:387/765 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 WRLGRPIGKGNFGEIFLASDDTVCPASSETAKYVVKIEPHSNGPLFVEIHCLINTSRNNDLSDAA 187
            :||||.||.|:||:|:|.::    .||.|  :..:|:|            | :.|..        
Human     9 YRLGRKIGSGSFGDIYLGAN----IASGE--EVAIKLE------------C-VKTKH-------- 46

  Fly   188 EDAASLPAPQTHVLSR-------GPPSGIPSFIASGTHYFGDVRYRFLVLPRFDRDLHSLIK--N 243
                    ||.|:.|:       |  .||||....|..  ||  |..:|:......|..|..  :
Human    47 --------PQLHIESKFYKMMQGG--VGIPSIKWCGAE--GD--YNVMVMELLGPSLEDLFNFCS 97

  Fly   244 SRVQQKSLLVLAVHIINVLENLHDKGYCHNDIKAQNLMVSKCKYLRRQVVPKGNGYEDHYEEKQQ 308
            .:...|::|:||..:|:.:|.:|.|.:.|.|:|..|.::...|        |||           
Human    98 RKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGK--------KGN----------- 143

  Fly   309 TTDSGNSSEQETNDDDYFLKSEKFALKKIVDIKQDEDEDDEDFDDGATSNSNNSNSLDVFHTPVN 373
                                                                             
Human   144 ----------------------------------------------------------------- 143

  Fly   374 KKRSARNAIQFSGSNPVRACRREKRNSMYEEMVKSHYLRPTKRISYREEFNEDGYPKETAENSDE 438
                                                                             
Human   144 ----------------------------------------------------------------- 143

  Fly   439 SPESSDNESDEFIPPSSRRSVIKRGRSAQIATPKKTPVSTRASRQEKVKKEPNGDQKLRSRGSKH 503
                                                                             
Human   144 ----------------------------------------------------------------- 143

  Fly   504 LDNNPTEYKFLPTEEEHVFLIDFGLASKFQDRGVHRPFIMDQRRAHDGTLEFTSRDAHLG-AHSR 567
                            .|::||||||.|::|...|:.....:.:...||..:.|.:.||| ..||
Human   144 ----------------LVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR 192

  Fly   568 RSDLECLGYNLLYWSEGYLPWKDVAQQQQQEKVHRAKELFMTDVPEMLRQFYGKQVPKYLGEFLL 632
            |.|||.|||.|:|::.|.|||:.:....:::|..|..|..|:...|:|.:.|    |.....:|.
Human   193 RDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGY----PSEFSTYLN 253

  Fly   633 QIGQLAYQERPNYERYRKIFKREYQRLGYDPCQMRLSSEEILRTCVSTKDVVDGSKCDIFELNNK 697
            ....|.:.::|:|...|::|:..:.|.|:                         |...:|:.|  
Human   254 FCRSLRFDDKPDYSYLRQLFRNLFHRQGF-------------------------SYDYVFDWN-- 291

  Fly   698 AAVNVMRNSTLSTPFQEHSLTNRVSPKNLRSKSNKKTTKKKFSWAEVLSQDPDQIARERAVKEFE 762
                                                  ..||..|    ::|:.:.|||  :|.|
Human   292 --------------------------------------MLKFGAA----RNPEDVDRER--REHE 312

  Fly   763 REETICPLESRLPRRY-EGKPTYAILDMEQRRREKGLVVQEHIEEEEEDADEDDEEENQEAMDID 826
            |||.:..|.....|.. .|.||.|              ....:....|..........|.|    
Human   313 REERMGQLRGSATRALPPGPPTGA--------------TANRLRSAAEPVASTPASRIQPA---- 359

  Fly   827 QEEDGEAADSAEGEDESDRSMEGSDCSDHSQKRARGRPKGTSRKQTTSRQ 876
                |..:..|....:.:|.:        |.:..||.|...|....|.||
Human   360 ----GNTSPRAISRVDRERKV--------SMRLHRGAPANVSSSDLTGRQ 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357 46/171 (27%)
SPS1 123..>284 CDD:223589 46/169 (27%)
SPS1 <491..756 CDD:223589 55/265 (21%)
PKc_like <517..652 CDD:304357 44/135 (33%)
CSNK1ENP_001885.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 96/547 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..416 29/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.