DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and CSNK1A1

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001020276.1 Gene:CSNK1A1 / 1452 HGNCID:2451 Length:365 Species:Homo sapiens


Alignment Length:560 Identity:110/560 - (19%)
Similarity:171/560 - (30%) Gaps:251/560 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 NGTILRDVLSKAWRLGRPIGKGNFGEIFLASDDTVCPASSETAKYVVKIEPHSNGPLFVEIHCLI 175
            :|:....::...::|.|.||.|:||:|:||.:.|   ...|.|   ||:|               
Human     5 SGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINIT---NGEEVA---VKLE--------------- 48

  Fly   176 NTSRNNDLSDAAEDAASLPAPQTHVLSRGPPSGIPSFIASGTHYFGDVR-YRFLVLPRFDRDLHS 239
                    |..|.....|...:.:.:.:| ..|||..     .::|..: |..||:......|..
Human    49 --------SQKARHPQLLYESKLYKILQG-GVGIPHI-----RWYGQEKDYNVLVMDLLGPSLED 99

  Fly   240 LIK--NSRVQQKSLLVLAVHIINVLENLHDKGYCHNDIKAQNLMVSKCKYLRRQVVPKGNGYEDH 302
            |..  :.|...|::|:||..:|:.:|.:|.|.:.|.|||..|.::             |.|    
Human   100 LFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLM-------------GIG---- 147

  Fly   303 YEEKQQTTDSGNSSEQETNDDDYFLKSEKFALKKIVDIKQDEDEDDEDFDDGATSNSNNSNSLDV 367
                                                                             
Human   148 ----------------------------------------------------------------- 147

  Fly   368 FHTPVNKKRSARNAIQFSGSNPVRACRREKRNSMYEEMVKSHYLRPTKRISYREEFNEDGYPKET 432
                                   |.|.:                                     
Human   148 -----------------------RHCNK------------------------------------- 152

  Fly   433 AENSDESPESSDNESDEFIPPSSRRSVIKRGRSAQIATPKKTPVSTRASRQEKVKKEPNGDQKLR 497
               ..|||                  |.||.||..::|.:....|                    
Human   153 ---CLESP------------------VGKRKRSMTVSTSQDPSFS-------------------- 176

  Fly   498 SRGSKHLDNNPTEYKFLPTEEEHVFLIDFGLASKFQDRGV--HRPFIMDQRRAHDGTLEFTSRDA 560
              |...|                 ||||||||.|::|...  |.|:..|:...  ||..:.|.:|
Human   177 --GLNQL-----------------FLIDFGLAKKYRDNRTRQHIPYREDKNLT--GTARYASINA 220

  Fly   561 HLG-AHSRRSDLECLGYNLLYWSEGYLPWKDVAQQQQQEKVHRAKELFMTDVPEMLRQFYGKQVP 624
            ||| ..|||.|:|.|||.|:|::...|||:.:....:::|..:..|..|:...|:|    .|..|
Human   221 HLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVL----CKGFP 281

  Fly   625 KYLGEFLLQIGQLAYQERPNYERYRKIFKREYQRLG--YD 662
            .....:|.....|.::|.|:|...|::|:..::.|.  ||
Human   282 AEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYD 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357 44/176 (25%)
SPS1 123..>284 CDD:223589 43/163 (26%)
SPS1 <491..756 CDD:223589 52/177 (29%)
PKc_like <517..652 CDD:304357 46/137 (34%)
CSNK1A1NP_001020276.1 STKc_CK1_alpha 16..309 CDD:271030 105/535 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.