DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INS and Ilp3

DIOPT Version :10

Sequence 1:NP_000198.1 Gene:INS / 3630 HGNCID:6081 Length:110 Species:Homo sapiens
Sequence 2:NP_648360.2 Gene:Ilp3 / 39151 FlyBaseID:FBgn0044050 Length:120 Species:Drosophila melanogaster


Alignment Length:122 Identity:31/122 - (25%)
Similarity:51/122 - (41%) Gaps:21/122 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     1 MALWMR------LLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAE 59
            |.:.||      |||.|.||.|.   .........|||..|.|.|..:|   .:.:...|:|..:
  Fly     1 MGIEMRCQDRRILLPSLLLLILM---IGGVQATMKLCGRKLPETLSKLC---VYGFNAMTKRTLD 59

Human    60 DLQVGQVELGGGPGAGSLQPLALEGSLQ-------KRGIVEQCCTSICSLYQLENYC 109
            .:...|::  |......|:.|..:.|:|       :.|:.::||...|::.::..||
  Fly    60 PVNFNQID--GFEDRSLLERLLSDSSVQMLKTRRLRDGVFDECCLKSCTMDEVLRYC 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INSNP_000198.1 IlGF_insulin_like 26..110 CDD:239833 21/91 (23%)
Ilp3NP_648360.2 IlGF_insulin_bombyxin_like 33..114 CDD:239832 19/85 (22%)

Return to query results.
Submit another query.