DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INS and Ilp1

DIOPT Version :10

Sequence 1:NP_000198.1 Gene:INS / 3630 HGNCID:6081 Length:110 Species:Homo sapiens
Sequence 2:NP_648359.1 Gene:Ilp1 / 39149 FlyBaseID:FBgn0044051 Length:154 Species:Drosophila melanogaster


Alignment Length:108 Identity:32/108 - (29%)
Similarity:47/108 - (43%) Gaps:26/108 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    27 NQHLCGSHLVEALYLVCGERGFFYTPKTRR----EAEDLQVGQVELGGG-------PGAG-SLQP 79
            |..|||..|.:|:.:|| ..||...|:.|.    .::|.:..:.|:...       .||| |..|
  Fly    45 NHKLCGPALSDAMDVVC-PHGFNTLPRKRESLLGNSDDDEDTEQEVQDDSSMWQTLDGAGYSFSP 108

Human    80 LA--LEGS---LQKR--------GIVEQCCTSICSLYQLENYC 109
            |.  |.||   ::.|        |:.::||...||..:|..||
  Fly   109 LLTNLYGSEVLIKMRRHRRHLTGGVYDECCVKTCSYLELAIYC 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INSNP_000198.1 IlGF_insulin_like 26..110 CDD:239833 32/108 (30%)
Ilp1NP_648359.1 IlGF_insulin_bombyxin_like <131..151 CDD:239832 6/19 (32%)

Return to query results.
Submit another query.