DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INS and Ilp5

DIOPT Version :10

Sequence 1:NP_000198.1 Gene:INS / 3630 HGNCID:6081 Length:110 Species:Homo sapiens
Sequence 2:NP_996037.2 Gene:Ilp5 / 2768992 FlyBaseID:FBgn0044048 Length:108 Species:Drosophila melanogaster


Alignment Length:117 Identity:29/117 - (24%)
Similarity:44/117 - (37%) Gaps:35/117 - (29%)


- Green bases have known domain annotations that are detailed below.


Human     7 LLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVC-----------GERGFFYTPKTRREAED 60
            |:|||.        .|.|..:...||..|::.|.:.|           |..|.|       :.||
  Fly    13 LIPLLL--------SAQAANSLRACGPALMDMLRVACPNGFNSMFAKRGTLGLF-------DYED 62

Human    61 LQVGQVELGGGPGAGSLQPLALEGSLQK--RGIVEQCCTSICSLYQLENYCN 110
             .:..::........||      .|:::  ||:|:.||...||...|..||:
  Fly    63 -HLADLDSSESHHMNSL------SSIRRDFRGVVDSCCRKSCSFSTLRAYCD 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INSNP_000198.1 IlGF_insulin_like 26..110 CDD:239833 22/96 (23%)
Ilp5NP_996037.2 IlGF_insulin_bombyxin_like 29..106 CDD:239832 21/90 (23%)

Return to query results.
Submit another query.