DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INS and ins-1

DIOPT Version :10

Sequence 1:NP_000198.1 Gene:INS / 3630 HGNCID:6081 Length:110 Species:Homo sapiens
Sequence 2:NP_501926.1 Gene:ins-1 / 177936 WormBaseID:WBGene00002084 Length:109 Species:Caenorhabditis elegans


Alignment Length:125 Identity:33/125 - (26%)
Similarity:42/125 - (33%) Gaps:43/125 - (34%)


- Green bases have known domain annotations that are detailed below.


Human     4 WMR-------LLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVC------GERGF------F 49
            |.|       ....||:|.|..|.|:.|.:  .||||.|...|..||      |...|      .
 Worm     3 WFRQVYRPSFFFGFLAILLLSSPTPSDASI--RLCGSRLTTTLLAVCRNQLCTGLTAFKRSADQS 65

Human    50 YTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYC 109
            |.|.||    ||                  ..:....::.||..:||...||...|:.:|
 Worm    66 YAPTTR----DL------------------FHIHHQQKRGGIATECCEKRCSFAYLKTFC 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INSNP_000198.1 IlGF_insulin_like 26..110 CDD:239833 24/96 (25%)
ins-1NP_501926.1 IlGF_insulin_bombyxin_like 34..103 CDD:239832 23/90 (26%)

Return to query results.
Submit another query.