DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-4 and Zmynd15

DIOPT Version :10

Sequence 1:NP_610730.1 Gene:Smyd4-4 / 36299 FlyBaseID:FBgn0027495 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_001025100.1 Gene:Zmynd15 / 574428 MGIID:3603821 Length:736 Species:Mus musculus


Alignment Length:133 Identity:34/133 - (25%)
Similarity:45/133 - (33%) Gaps:46/133 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 RDLAVGDLVSVEE-----PFCSTLL--TPMR-----------YIRCATC----KRENYLTLIPCD 245
            |.|.|||.....|     |.....|  ||||           .:|..||    |....:.|.||.
Mouse   259 RQLTVGDAHLHRELESLVPRLGVKLAKTPMRTWGPRPGFTFASLRARTCHVCHKHSFEVKLTPCP 323

  Fly   246 SCCSTMFCSEEC-----KSIAMQTYHRYECPIID-FLNRM------------------FNKIHCI 286
            .|.:.::|.|.|     :.......||:.||.:. |:.|:                  |||...:
Mouse   324 QCSAVLYCGEACLQADWRRCPDDVSHRFWCPRLSAFMERVGELASLPFTYTAEVTSETFNKEAFL 388

  Fly   287 ALR 289
            |.|
Mouse   389 ASR 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-4NP_610730.1 SET_SMYD4 180..491 CDD:380934 34/133 (26%)
zf-MYND 230..270 CDD:460312 12/48 (25%)
Zmynd15NP_001025100.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..94
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..192
zf-MYND 307..353 CDD:460312 11/45 (24%)
MSS51_C 478..672 CDD:466330
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 556..583
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 696..736
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.