DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-4 and smyd1b

DIOPT Version :9

Sequence 1:NP_610730.1 Gene:Smyd4-4 / 36299 FlyBaseID:FBgn0027495 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_001034725.1 Gene:smyd1b / 569027 ZFINID:ZDB-GENE-060522-1 Length:486 Species:Danio rerio


Alignment Length:430 Identity:82/430 - (19%)
Similarity:144/430 - (33%) Gaps:142/430 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 LELRETAAEGRFVVTNRDLAVGDLVSVEEPFCSTLLTPMRYIRCATCKRENYLTLIPCDSCCSTM 251
            :|:.::..:||.:...::...||::..|.||.|.:........|.:|.|... .|..|..|....
Zfish     4 VEVFDSPGKGRGLRATKEAWAGDVLFAEPPFASVVFDSQASSICHSCFRRQE-KLQRCGQCRFAQ 67

  Fly   252 FCSEECKSIAMQTYHRYECPIIDFLNRMFNKIHCIALRTTLVALNIFPSIEELIDFCEQEQNQDK 316
            :|.:.|:....:.:                |:.|.|::|                          
Zfish    68 YCDKTCQRAGWEEH----------------KLECAAIKT-------------------------- 90

  Fly   317 CAFDLNYNELTPEEHYRAI----------HGLVTNQHLRSVSDLFQRSVVCAV----LKHFIIEY 367
                  |.: .|.|:.|..          ..:|::..|.::.||  ...:|.:    ||.|.:: 
Zfish    91 ------YGK-PPSENVRLAARILWRMDKQGSVVSDNQLTTLEDL--EDHICDISEDDLKDFKVD- 145

  Fly   368 TPVKEYLGGEEGVNFFTDLLFRHLQTSPSNMHGIDLVE-----------QVNETKDDQTHSSGAY 421
                        ::.|.|...|:     |..|.:|.|.           .|::.:..|....|.:
Zfish   146 ------------IHNFLDYWPRN-----SKPHTVDSVSHILGVINCNGFMVSDQRGLQAVGVGLF 193

  Fly   422 AFLSLINHSCAPN-TVRIYEGTKA------------YMFVLRPIKAGNVLYDNYGAHFAICSKEQ 473
            ..|.|:||.|.|| ||.:..|.::            .:..|..|.||..:...|..:..:.:..|
Zfish   194 PNLCLVNHDCWPNCTVILNNGNQSAIDTVFHSQKRIELRALGKISAGEEVTVAYVDYLNVSADRQ 258

  Fly   474 RLKRLSLQYRFDCKCEGC-------------ELNYPMFGMMPHKATVPSVTDDTELALSSYNYDF 525
            ||  |..||.|||.|:.|             |::    |:...:..|..||:.:...|.......
Zfish   259 RL--LKQQYFFDCTCKHCTEKIKDDLKMAGAEVD----GVKVPEEQVKEVTEFSRQKLEKMEKAR 317

  Fly   526 AVSNYRKYCDFLTQYGDDYPCEQISSAEECLKMALHIMAD 565
            ..:||.               |.:....||::...:::||
Zfish   318 IEANYN---------------EVVKICRECVEKQENVLAD 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-4NP_610730.1 TPR_11 67..138 CDD:290150
zf-MYND 230..270 CDD:280009 8/39 (21%)
SET 363..463 CDD:279228 25/123 (20%)
smyd1bNP_001034725.1 zf-MYND 47..85 CDD:280009 9/54 (17%)
SET <173..247 CDD:214614 17/73 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.