DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-4 and Smyd3

DIOPT Version :9

Sequence 1:NP_610730.1 Gene:Smyd4-4 / 36299 FlyBaseID:FBgn0027495 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_524768.2 Gene:Smyd3 / 44554 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster


Alignment Length:302 Identity:63/302 - (20%)
Similarity:113/302 - (37%) Gaps:75/302 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 GDLVSVEEPFCSTLLTPMRYIRCATCKRENYLTLIPCDSCCSTMFCSEECKSIAMQTY--HRYEC 270
            |..:..|:||...|.:..|..||..|....  .::.|.:|....:|...|:   ||.:  |::||
  Fly    38 GQRILTEKPFAFVLKSQYRLERCDNCLEAT--KVLKCSNCRYVSYCHRSCQ---MQAWGQHKHEC 97

  Fly   271 PIIDFLNRMFNKIHCIALRTTLVALNIFPSIEELIDFCEQEQNQDKCAFDLNYNELTPEEHYRAI 335
            |.:       .|:|          ..:.|....::           |...|..     |.....|
  Fly    98 PFL-------KKVH----------PRVVPDAARML-----------CRLILRL-----EHGGDLI 129

  Fly   336 HGLVTNQHLRSVSDLFQRSVVCAVLKHFI-IEYTPVK-EYLGGEEGVNFFTDLLFRHLQTSPSN- 397
            .|..|....|...||         :.|:. |:..|:: |:|.....|  .||::.....|.|:. 
  Fly   130 RGYYTEHGSRKFRDL---------MSHYAEIKNDPMRLEHLDSLHAV--LTDMMAESPSTVPNKT 183

  Fly   398 ----------MHGIDLVE-QVNETKDDQTHSSGAYAFLSLINHSCAPNTVRIYEGTKAYMFVLRP 451
                      .:|.:::: ::|..      ::..|..:|:.:|||.||.|..:||.:.::..:..
  Fly   184 ELMSIYGRLITNGFNILDAEMNSI------ATAIYLGVSITDHSCQPNAVATFEGNELHVHAIED 242

  Fly   452 IKA--GNVLYDNYGAHFAICSKEQRLKRLSLQYRFDCKCEGC 491
            ::.  .:.::.:|  ...:.:.|||...|...|.|.|.|..|
  Fly   243 MECLDWSKIFISY--IDLLNTPEQRRLDLKEHYYFLCVCSKC 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-4NP_610730.1 TPR_11 67..138 CDD:290150
zf-MYND 230..270 CDD:280009 9/41 (22%)
SET 363..463 CDD:279228 21/115 (18%)
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009 9/41 (22%)
TPR_12 377..440 CDD:290160
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.