DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-4 and SmydA-1

DIOPT Version :9

Sequence 1:NP_610730.1 Gene:Smyd4-4 / 36299 FlyBaseID:FBgn0027495 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_610944.1 Gene:SmydA-1 / 36581 FlyBaseID:FBgn0033917 Length:513 Species:Drosophila melanogaster


Alignment Length:366 Identity:70/366 - (19%)
Similarity:110/366 - (30%) Gaps:143/366 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 GRFVVTNRDLAVGDLVSVEEPFC---STLLTPMRYIRCATC----KRENYLTLIPCDSCCSTMFC 253
            ||.:|..|.:...::|..|.|..   :.:..|:    |..|    :.|::   |.|:. |....|
  Fly    52 GRHLVATRTIKPYEIVLKEAPLVRGPAQISAPV----CLGCLNGIEAEDH---IECEQ-CGWPLC 108

  Fly   254 SEECKSIAMQTYHRYECPII----------DF-----LNRMFNKIHCIAL-RTTLVALNIFPSIE 302
            ..||||:   ..|:.||.:.          :|     |....:.:.|:.: .|:....:.|..:|
  Fly   109 GPECKSL---DEHKAECGLTKDRGQKVNVQEFGGPHPLYTCLSTVRCLLIGETSTEKASKFQDLE 170

  Fly   303 ELIDFCEQEQNQDKCAFDL-----------NYNELTPEEHYRAIHGLVTNQHLRSVSDLFQRSVV 356
            .| :...:..||.|.  ||           ...:.|.||..:|:..|..|.|....:|       
  Fly   171 SL-ESTRRGSNQWKA--DLVSIGQFIPKFFKTQKFTEEEIMKAVGALQINGHEVPTTD------- 225

  Fly   357 CAVLKHFIIEYTPVKEYLGGEEGVNFFTDLLFRHLQTSPSNMHGIDLVEQVNETKDDQTHSSGAY 421
               ..|..:.||                                                     
  Fly   226 ---PSHVAVFYT----------------------------------------------------- 234

  Fly   422 AFLSLINHSCAPNTVRIY-EGTKAYMFVLRPIKAGNVLYDNYGAHFAICSKE------QRLKRLS 479
              .|...:||.||..:.: :.....::..|.||.        .||.:||..:      .|.:.|.
  Fly   235 --ASFTENSCLPNLAKSFNKNGHCILWAPREIKK--------NAHLSICYSDAMWGTADRQRHLM 289

  Fly   480 LQYRFDCKCEGC------ELNYPMFG---------MMPHKA 505
            ....|.|.||.|      :.||....         |:|.||
  Fly   290 QTKLFKCACERCVDVTELDTNYSAIKCEDRQCGGLMLPTKA 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-4NP_610730.1 TPR_11 67..138 CDD:290150
zf-MYND 230..270 CDD:280009 12/43 (28%)
SET 363..463 CDD:279228 10/100 (10%)
SmydA-1NP_610944.1 zf-MYND 4..40 CDD:280009
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.