DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-4 and SmydA-3

DIOPT Version :9

Sequence 1:NP_610730.1 Gene:Smyd4-4 / 36299 FlyBaseID:FBgn0027495 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_001260366.1 Gene:SmydA-3 / 34502 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster


Alignment Length:435 Identity:93/435 - (21%)
Similarity:156/435 - (35%) Gaps:140/435 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 LELRETAAE-----GRFVVTNRDLAVGDLVSVEEPF-----CSTLLTPMRYIRCATCKRENYLTL 241
            |.:..||.:     ||::|....:....|:..|.||     |:..:.      |..|...|   .
  Fly     7 LSVNRTAVQWSPVCGRYLVAKGAIRGHGLLIEELPFAVGPKCNGPVV------CLGCYEPN---P 62

  Fly   242 IPCDSCCSTM---FCSEECKSIAMQTYHRYEC-PIIDFLNRMFN---------KIHCIALRTTLV 293
            .|.:..||..   .| .||...|...:.|.|| .:.|...|.|.         ::.||.....|:
  Fly    63 DPEEELCSECGWPLC-VECAQQADNAHFRLECSQLKDARARFFRLPSGSRHCPQLDCIMPLRVLL 126

  Fly   294 ALNIFPSIEELIDFCEQEQNQDKCAFDLNYNELTPEEHYRAIHGLVTNQHLRSVSDLFQRSVVCA 358
            |               :|.|.::  :|   ||:.|.||::        :..:..:|::....|  
  Fly   127 A---------------KEANPER--WD---NEVAPMEHHK--------EERQRDADVWHADRV-- 161

  Fly   359 VLKHFIIEYTPVKEYLGGE-EGVNFFTDLLFRHLQTSPSNMHGIDLVEQVN--ETKDDQTHSSGA 420
                      .:.:||.|. :..|.|::.|.         |..:.::| ||  |.:..:.:....
  Fly   162 ----------NIAQYLRGPCQLANRFSEELI---------MQVVGVLE-VNAFEARSPKGYPLRC 206

  Fly   421 -YAFLSLINHSCAPNTVR-IY--EGTKAYMFVLRPIKAGNVLYDNYGAHFAICSKEQRLKRLSLQ 481
             :.:..::.|:|.|||.| ||  ||.|..:..:..::.|..|:.:|  .:.:....||.|.|...
  Fly   207 LFPYTGILAHNCVPNTSRSIYPSEGYKIRLRAMVDLEEGQPLHHSY--TYTLDGTAQRQKHLKQG 269

  Fly   482 YRFDCKCEGC----ELNYPMFGM----------MPHKATVPSVTDDTELALSSYNYDFAVSNYRK 532
            ..|.|:||.|    ||......:          :|.:.|.|    ||     |:|    .:|   
  Fly   270 KFFTCQCERCLDPTELGTHFSSLKCGQCAEGFQVPRQPTEP----DT-----SWN----CAN--- 318

  Fly   533 YCDFLTQYGDDYPCEQISSAEECLKMALHIMAD-----AVPLKAK 572
                         |...:|..:.|.|...:.::     |:|:.||
  Fly   319 -------------CGSDTSNADALAMLQSLQSEVNAVQALPMAAK 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-4NP_610730.1 TPR_11 67..138 CDD:290150
zf-MYND 230..270 CDD:280009 11/42 (26%)
SET 363..463 CDD:279228 24/106 (23%)
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 13/44 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.