DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-4 and SmydA-9

DIOPT Version :9

Sequence 1:NP_610730.1 Gene:Smyd4-4 / 36299 FlyBaseID:FBgn0027495 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_001285040.1 Gene:SmydA-9 / 31859 FlyBaseID:FBgn0030102 Length:500 Species:Drosophila melanogaster


Alignment Length:412 Identity:79/412 - (19%)
Similarity:132/412 - (32%) Gaps:128/412 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 ELRETAAEGRFVVTNRDLAVGDLVSVEEPFCSTLLTPMR--YIRCATCKRENYLTLIP-----CD 245
            |:..:...||.||..|.|..|:::..:.|....|.....  ...|:.|     |.::|     |.
  Fly    26 EIGVSKIAGRGVVATRSLKRGEIIFRDSPLLIGLAAHEEDSLNACSVC-----LKMLPDTRFMCR 85

  Fly   246 SCCSTMFCSEECKSIAMQTYHRYECPII--------DFLNRMFNKIHCIALRTTLVALNIFPSIE 302
            ..|....||    ..|.:..|:.:|.:.        |..|.:..::.|:|.     |:|:.....
  Fly    86 QGCGLPVCS----LCAKKKQHKSDCDLFKSWGPNEPDVANSVIIRLLCVAR-----AINLSKEQR 141

  Fly   303 ELIDFCEQEQNQDKCAFDLNYNELTPEEHYRAIHGLVTNQHLRSVSDLFQRSVVCAVLKHFIIEY 367
            :|| :|.|.        :|:.|..|               .:|:.:..|:               
  Fly   142 DLI-YCLQA--------NLDNNHRT---------------EVRNAAKCFK--------------- 167

  Fly   368 TPVKEYLGGEEGVNFFTD-----LLFRHLQTSPSNMHGIDLVEQVNETKDDQTHSSGA-YAFLSL 426
                         ||.||     ::.|.:....:|  |.|  :..:.|.|:|..:..| |....:
  Fly   168 -------------NFPTDKKLIEIMNRTVAVLRTN--GFD--KTTDRTNDNQEFNYRALYPLFGV 215

  Fly   427 INHSCAPNTVRIYEGTKAYMFVLR---PIKAGNVLYDNYGAHFAICSKEQRLKRLSLQYRFDCKC 488
            :||.|.||....:| .|....::|   .|..|..:...|...|.  ....|...|.::..|.|||
  Fly   216 VNHDCIPNAYYTFE-EKTNNMIVRAAVDIPEGFEVTTTYTKLFT--GNIARHLFLKMKKSFTCKC 277

  Fly   489 EGCE---------------------LNYPMFGMMPH----------KATVPSVTDDTELALSSYN 522
            ..|.                     |..|....:||          |:|...:....:.|..:.|
  Fly   278 SRCSDPTEKGAFISGLYCRDTNCTGLVVPEITGLPHPNWNCLVCKQKSTHAQMMKSQDFASGAIN 342

  Fly   523 YDFAVSNYRKYCDFLTQYGDDY 544
            .....::.|....:|.:..|.:
  Fly   343 AKVNSNSLRTLVQYLNEKSDSF 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-4NP_610730.1 TPR_11 67..138 CDD:290150
zf-MYND 230..270 CDD:280009 10/44 (23%)
SET 363..463 CDD:279228 23/108 (21%)
SmydA-9NP_001285040.1 SET 25..>66 CDD:295368 10/39 (26%)
SET <216..253 CDD:279228 10/37 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.