DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-4 and SmydA-9

DIOPT Version :10

Sequence 1:NP_610730.1 Gene:Smyd4-4 / 36299 FlyBaseID:FBgn0027495 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_572539.2 Gene:SmydA-9 / 31859 FlyBaseID:FBgn0030102 Length:500 Species:Drosophila melanogaster


Alignment Length:36 Identity:9/36 - (25%)
Similarity:17/36 - (47%) Gaps:10/36 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 HINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAG 50
            |..:.::..||       :||..|.::|:   :|.|
  Fly    61 HPRMNIVELDN-------RKHEDLLQIMS---NRTG 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-4NP_610730.1 SET_SMYD4 180..491 CDD:380934
zf-MYND 230..270 CDD:460312
SmydA-9NP_572539.2 SET 26..>49 CDD:394802
SET_SMYD <183..280 CDD:380997
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.