DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-4 and Smyd5

DIOPT Version :9

Sequence 1:NP_610730.1 Gene:Smyd4-4 / 36299 FlyBaseID:FBgn0027495 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_001101340.1 Gene:Smyd5 / 312503 RGDID:1309153 Length:417 Species:Rattus norvegicus


Alignment Length:410 Identity:90/410 - (21%)
Similarity:143/410 - (34%) Gaps:129/410 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 TAAEGRFVVTNRDLAVGDLVSVEEPFCSTLL---TPMRYIRCATCKR------ENYLTL------ 241
            ::|:|:.:...:.:..|:.:.:|.|..::..   ...||..|..|.|      ||...|      
  Rat    29 SSAKGKGLFATQLIRKGETIFIERPLVASQFLWNALYRYRACDHCLRALEKAEENAQRLTGKPGQ 93

  Fly   242 -IP----C-------DSC--CSTMFCSEECKSIAMQTYHRYECP---------IIDFLNRMFNKI 283
             :|    |       .:|  |...:||.||:..|.:.||:..||         .::.|...:..:
  Rat    94 VLPHPELCSVRKDLHQNCPRCQVTYCSAECRLAAAEQYHQILCPGPSQDDPRHPLNKLQEAWRSV 158

  Fly   284 H------CIALRTTLVALNIFPSIEELID----------FCEQEQNQ----------DKCAFDLN 322
            |      .|.|...:||     ::::..|          ||.:..|:          ||....|.
  Rat   159 HYPPETASIMLMARMVA-----TVKQAKDKDHWVRLFSHFCSKTANEEEEIVHKLLGDKFKGQLE 218

  Fly   323 ----------YNE-----LTPEEHYRAIHGLV-TNQHLRSVSDLFQRSVVCAVLKHFIIEYTPVK 371
                      |.|     .|| :.:|::..|| ||......|.|.|....|..|     |..|.:
  Rat   219 LLRRLFTEALYEETLSQWFTP-DGFRSLFALVGTNGQGIGTSSLSQWVHACDAL-----ELKPQE 277

  Fly   372 EYLGGEEGVNFFTDLLFRHLQTSPSNMHGIDLVEQVNETKDDQTHSSGAYAFLSLINHSCAPNTV 436
                 .|.::.|.|.|::.::.:..        |.:|      ...||.:...|..||||.||..
  Rat   278 -----REQLDTFIDQLYKDIEAATG--------EFLN------CEGSGLFVLQSCCNHSCVPNAE 323

  Fly   437 RIYEGTKAYMFV--LRPIKAGNVLYDNYGAHFAICSKEQ----RLKRLSLQYRFDCKCEGCELNY 495
            ..:......:.|  |..|:.|..:..:|   ...|.:|:    |.|.|...|.|.|.|..|..  
  Rat   324 TSFPENNFLLHVTALEDIEPGEEICISY---LDCCQRERSRHSRHKILRENYLFVCSCPKCLA-- 383

  Fly   496 PMFGMMPHKATVPSVTDDTE 515
                    :|..|:||.:.|
  Rat   384 --------EADDPNVTSEEE 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-4NP_610730.1 TPR_11 67..138 CDD:290150
zf-MYND 230..270 CDD:280009 17/65 (26%)
SET 363..463 CDD:279228 21/101 (21%)
Smyd5NP_001101340.1 DUF4599 68..144 CDD:292015 19/75 (25%)
SET <298..351 CDD:214614 15/58 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.