DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-4 and SmydA-8

DIOPT Version :9

Sequence 1:NP_610730.1 Gene:Smyd4-4 / 36299 FlyBaseID:FBgn0027495 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_001014717.1 Gene:SmydA-8 / 31200 FlyBaseID:FBgn0053548 Length:462 Species:Drosophila melanogaster


Alignment Length:322 Identity:65/322 - (20%)
Similarity:105/322 - (32%) Gaps:80/322 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 LRETAAEGRFVVTNRDLAVGDLVSVEEPFCSTLLTPMRYIRCATCKRE----------NYLTLIP 243
            :..:...||.|...||:|.|:|:..|....:........:....|..|          :..||..
  Fly    59 ISSSTVAGRGVFATRDIAAGELIFQERALVTGPTARKGQLSSCICCHETLPQTGFLCRHRCTLPV 123

  Fly   244 CDSCCSTMFCSEECKSIAMQTYHRYECPIIDFLNRMFNKIHCIALRTTLVALNIFPSIEE---LI 305
            |::|..:.....||     :.:.|::...:|......|.   ::|| .|.|:.:|...:|   |:
  Fly   124 CETCSDSEEHQAEC-----EHFRRWQPKDVDAEQEQVNP---MSLR-ILTAVRVFHLGKEQRHLV 179

  Fly   306 DFCEQEQNQDKCAFDLNYNELTPEEHYRAIHGLVTNQHLRSVSDLFQRSVVCAV--LKHFIIEYT 368
            |           |...|     .|..||                   |.::.|.  .::|     
  Fly   180 D-----------AMQAN-----AERAYR-------------------REIIQAAQCFRNF----- 204

  Fly   369 PVKEYLGGEEGVNFFTDLLFRHLQTSPSNMHGIDLVEQVNETKDDQTHSSGAYAFLSLINHSCAP 433
            |..:        ..|.|.|||.:....:|     ..|....:...:|...|.:...:::||.|.|
  Fly   205 PTTD--------RVFMDQLFRIVGVLNTN-----AFEAPCRSGGHETLLRGLFPLTAIMNHECTP 256

  Fly   434 NTVRIYE-GTKAYMFVLRPIKAGNVLYDNYGAHFAICSKEQRLKRLSLQYRFDCKCEGCELN 494
            |....:| |..|.:...|.|..|..:...|..  .:.....|...|.:...|.|.|..|..|
  Fly   257 NASHYFENGRLAVVRAARDIPKGGEITTTYTK--ILWGNLTRNIFLKMTKHFACDCVRCHDN 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-4NP_610730.1 TPR_11 67..138 CDD:290150
zf-MYND 230..270 CDD:280009 9/49 (18%)
SET 363..463 CDD:279228 22/100 (22%)
SmydA-8NP_001014717.1 SET <189..293 CDD:214614 27/142 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.