DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-4 and set-30

DIOPT Version :9

Sequence 1:NP_610730.1 Gene:Smyd4-4 / 36299 FlyBaseID:FBgn0027495 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_508850.2 Gene:set-30 / 180772 WormBaseID:WBGene00022499 Length:560 Species:Caenorhabditis elegans


Alignment Length:326 Identity:76/326 - (23%)
Similarity:115/326 - (35%) Gaps:109/326 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 DLVSVEE-----------PFCSTLLTPMRYIRCATCKRENYLTLIPCDSCCSTMFCSEECK-SIA 261
            ::|.||:           ||..:||...:...|.||..||  ..:.|:.|....|||::|: |.|
 Worm     9 EVVGVEKIGSKPRSKEFYPFAYSLLDCTKDDYCWTCLGEN--VELTCEQCKVAKFCSKQCETSGA 71

  Fly   262 MQTYHRYEC-PIIDFLNRMFNKIHCIALRTTLVALNIFPSIEELIDFCEQEQNQDKCAFDLNYNE 325
            :.  |:||| |:                                          .||. |||.:|
 Worm    72 ID--HKYECGPL------------------------------------------KKCP-DLNTDE 91

  Fly   326 ---LTPEEHYRAIH--------GLVTN-QHLRSVSDLFQRSVVCA-------VLKHFIIEYTPVK 371
               :.....|:.||        |...| :..|||.::::.   ||       .:|.|...|..||
 Worm    92 RMLIRIVGRYKDIHSGKDKSIDGFYNNRESKRSVMEIWEH---CADMKKDENAMKSFKKTYDRVK 153

  Fly   372 EYLGGEEGVNFFTDLLFRHLQTSPSNMHGIDLVEQVNETKDDQTHSSGAYAFLSLINHSCAPNTV 436
            ::  |:.......::.|:....:..|.|.|..|:.:.|.      ..|.|..|...:|||.||.:
 Worm   154 QF--GDTNHLMDEEVTFQLHSRNFINRHSISNVDYLREI------GKGLYLDLCKYDHSCRPNAI 210

  Fly   437 RIYEGTKAYMFVLRPIKAGNVLYDNYG------AHFAICS----KEQRLKRLSLQYRFDCKCEGC 491
            ....|..|.:         ..|:||..      .|:....    |.||...|...:.|:|.||.|
 Worm   211 YSCNGIVAKL---------RALHDNVDLENVETTHYTYIELPPCKIQRRHMLKETWYFECHCERC 266

  Fly   492 E 492
            :
 Worm   267 D 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-4NP_610730.1 TPR_11 67..138 CDD:290150
zf-MYND 230..270 CDD:280009 15/40 (38%)
SET 363..463 CDD:279228 24/99 (24%)
set-30NP_508850.2 zf-MYND 41..78 CDD:366792 15/40 (38%)
SET_SMYD <179..266 CDD:380997 26/101 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.