DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SKP1

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_010615.3 Gene:SKP1 / 851928 SGDID:S000002736 Length:194 Species:Saccharomyces cerevisiae


Alignment Length:188 Identity:76/188 - (40%)
Similarity:110/188 - (58%) Gaps:33/188 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LESADKEIFDTDQEIAKCSETIRIAIEDL----------------------------GDESDNS- 41
            |.|.:.|.|..|::||:.|..::..:.|:                            ||:.|.. 
Yeast     8 LVSGEGERFTVDKKIAERSLLLKNYLNDMHDSNLQNNSDSESDSDSETNHKSKDNNNGDDDDEDD 72

  Fly    42 ---VLPLPNVNSLILKKVLHWATYHKDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELIL 103
               |:|:|||.|.:|:||:.||.:|:|.....|: ::..:::..:.|||.:||||||..|:|:||
Yeast    73 DEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDED-DDDSRKSAPVDSWDREFLKVDQEMLYEIIL 136

  Fly   104 AANYLNIQGLLDVTCKTVANMIKGKSPQAIRDTFAIQNDFLPQEEEQVRKENEWCEDK 161
            |||||||:.|||..||.||.||:|:||:.||.||.|.|||.|:||..:|:||||.||:
Yeast   137 AANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEEEAAIRRENEWAEDR 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 75/186 (40%)
Skp1 1..110 CDD:214704 44/135 (33%)
Skp1 84..158 CDD:279768 47/73 (64%)
SKP1NP_010615.3 SKP1 3..194 CDD:227528 75/186 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344323
Domainoid 1 1.000 67 1.000 Domainoid score I2347
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 154 1.000 Inparanoid score I1094
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - otm46619
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
TreeFam 1 0.960 - -
1413.710

Return to query results.
Submit another query.