DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SKP1

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_565123.1 Gene:SKP1 / 843928 AraportID:AT1G75950 Length:160 Species:Arabidopsis thaliana


Alignment Length:155 Identity:85/155 - (54%)
Similarity:111/155 - (71%) Gaps:4/155 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKDDPV 68
            |.|:|:|.|.|:.::.:|..|:||...:||  |..||.| |||||.|.||.||:.:...|.:...
plant     6 IVLKSSDGESFEVEEAVALESQTIAHMVED--DCVDNGV-PLPNVTSKILAKVIEYCKRHVEAAA 67

  Fly    69 -VTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGKSPQA 132
             ..|.||......||:.:|||||:|:||.||||||||||||||:.|||:||:|||:|||||:|:.
plant    68 SKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEE 132

  Fly   133 IRDTFAIQNDFLPQEEEQVRKENEW 157
            ||.||.|:|||.|:|||:||:||:|
plant   133 IRTTFNIKNDFTPEEEEEVRRENQW 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 85/155 (55%)
Skp1 1..110 CDD:214704 52/106 (49%)
Skp1 84..158 CDD:279768 53/74 (72%)
SKP1NP_565123.1 BTB_POZ_SKP1 5..125 CDD:349631 62/121 (51%)
Skp1 111..158 CDD:396171 31/47 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 60 1.000 Domainoid score I3858
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.