DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SK4

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_564105.1 Gene:SK4 / 838604 AraportID:AT1G20140 Length:163 Species:Arabidopsis thaliana


Alignment Length:159 Identity:74/159 - (46%)
Similarity:109/159 - (68%) Gaps:9/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IIRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKDDP 67
            :|.|:|:|.|.|:.::.:|..|:||:..|||  |.:||.: |||||...||.||:.:...|.:  
plant     7 MIILKSSDGESFEIEEAVAVKSQTIKHMIED--DCADNGI-PLPNVTGAILAKVIEYCKKHVE-- 66

  Fly    68 VVTEEVENKE----KRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGK 128
            ...|...:|:    ...|::.:||::|:||||.|||:||||||||||.||||:|||.||:.::||
plant    67 AAAEAGGDKDFYGSAENDELKNWDSEFVKVDQPTLFDLILAANYLNIGGLLDLTCKAVADQMRGK 131

  Fly   129 SPQAIRDTFAIQNDFLPQEEEQVRKENEW 157
            :|:.:|..|.|:||:.|:||.:||.||:|
plant   132 TPEQMRAHFNIKNDYTPEEEAEVRNENKW 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 74/159 (47%)
Skp1 1..110 CDD:214704 47/110 (43%)
Skp1 84..158 CDD:279768 45/74 (61%)
SK4NP_564105.1 BTB_POZ_SKP1 7..128 CDD:349631 58/125 (46%)
Skp1 115..161 CDD:396171 25/46 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.