DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SK18

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_563864.2 Gene:SK18 / 837562 AraportID:AT1G10230 Length:158 Species:Arabidopsis thaliana


Alignment Length:155 Identity:66/155 - (42%)
Similarity:97/155 - (62%) Gaps:7/155 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKDDPV 68
            |.|.|:|.|.|:.|:.:|:   ...|.:..:.|......:||.||...||.|::.:|..|.::|.
plant     6 ILLTSSDGESFEIDEAVAR---KFLIIVHMMEDNCAGEAIPLENVTGDILSKIIEYAKMHVNEPS 67

  Fly    69 VTEEVENKEKRTDDISSWDADFL-KVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGKSPQA 132
            ..:|.|..:|..|   ||||.|: |:|..|:|::||||||||.:|||....:|||:.||.|:|:.
plant    68 EEDEDEEAKKNLD---SWDAKFMEKLDLETIFKIILAANYLNFEGLLGFASQTVADYIKDKTPEE 129

  Fly   133 IRDTFAIQNDFLPQEEEQVRKENEW 157
            :|:.|.|:|||.|:|||::||||.|
plant   130 VREIFNIENDFTPEEEEEIRKENAW 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 66/155 (43%)
Skp1 1..110 CDD:214704 40/106 (38%)
Skp1 84..158 CDD:279768 42/75 (56%)
SK18NP_563864.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.890

Return to query results.
Submit another query.