DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SK12

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_567967.1 Gene:SK12 / 829598 AraportID:AT4G34470 Length:152 Species:Arabidopsis thaliana


Alignment Length:159 Identity:75/159 - (47%)
Similarity:106/159 - (66%) Gaps:18/159 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IIRLESADKEIFDTDQEIAKCSETIRIAIED--LGDESDNSVLPLPNVNSLILKKVLHWA-TYHK 64
            :|.|.|:|.:.|:.::.:|..|:||...:||  :.|.     :||.||.|.||.||:.:. .||.
plant     5 MIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCVADG-----IPLANVESKILVKVIEYCKKYHV 64

  Fly    65 DDP-VVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGK 128
            |:. .::||         |::.||..|:.::|.|:||||||||||||:.|.|:||:|||:|||||
plant    65 DEANPISEE---------DLNKWDEKFMDLEQSTIFELILAANYLNIKSLFDLTCQTVADMIKGK 120

  Fly   129 SPQAIRDTFAIQNDFLPQEEEQVRKENEW 157
            :|:.||.||.|:|||.|:|||.|||||:|
plant   121 TPEEIRSTFNIENDFTPEEEEAVRKENQW 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 75/159 (47%)
Skp1 1..110 CDD:214704 42/110 (38%)
Skp1 84..158 CDD:279768 48/74 (65%)
SK12NP_567967.1 Skp1 3..102 CDD:214704 42/110 (38%)
SKP1 5..150 CDD:227528 75/159 (47%)
Skp1 77..150 CDD:279768 48/73 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.