DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SK21

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_567113.1 Gene:SK21 / 825314 AraportID:AT3G61415 Length:351 Species:Arabidopsis thaliana


Alignment Length:163 Identity:48/163 - (29%)
Similarity:82/163 - (50%) Gaps:22/163 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRLESADKEIFDTDQEIAK-----CSETIRIAIEDLGDESDNSVLPLP-NVNSLILKKVLHWATY 62
            |.||:||..|...:||:|.     |.|.|:..:    ..|.|..:.|| .||..:|..:..:..:
plant    18 IWLETADGSIQQVEQEVAMFCPMICQEVIQKGV----GSSKNYAISLPQRVNPAMLSLIFDYCRF 78

  Fly    63 HKDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKG 127
            |:     .....|||::.     :|..|:::|...|.||..||:.|.::.|:|:|.:.:|.:|:|
plant    79 HQ-----VPGRSNKERKV-----YDEKFIRMDTKRLCELTSAADSLQLKPLVDLTSRALARIIEG 133

  Fly   128 KSPQAIRDTFAIQNDFLPQEEEQVRKENEWCED 160
            |:|:.||:.|.:.:|.  .|||::.......:|
plant   134 KTPEEIREIFHLPDDL--TEEEKLEPLKNTMDD 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 48/163 (29%)
Skp1 1..110 CDD:214704 32/111 (29%)
Skp1 84..158 CDD:279768 24/73 (33%)
SK21NP_567113.1 Skp1 15..116 CDD:214704 32/111 (29%)
Skp1 90..153 CDD:279768 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.