DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SK5

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_567091.1 Gene:SK5 / 825172 AraportID:AT3G60020 Length:153 Species:Arabidopsis thaliana


Alignment Length:160 Identity:68/160 - (42%)
Similarity:103/160 - (64%) Gaps:20/160 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKDDPV 68
            |.|:|:|.:.|:.|:::|:.|..|...:|| |..:|  |:||.||.|.|||.|:.:...|     
plant     5 IMLKSSDGKSFEIDEDVARKSIAINHMVED-GCATD--VIPLRNVTSKILKIVIDYCEKH----- 61

  Fly    69 VTEEVENKEKRTDDISSWDADFLKVDQGT-LFELILAANYLNIQGLLDVTCKTV-----ANMIKG 127
                |::||:  :|:..|||||:|..:.| ||::::||||||||.|||:|||||     |:::.|
plant    62 ----VKSKEE--EDLKEWDADFMKTIETTILFDVMMAANYLNIQSLLDLTCKTVSDLLQADLLSG 120

  Fly   128 KSPQAIRDTFAIQNDFLPQEEEQVRKENEW 157
            |:|..||..|.|:||...:|..::|:||:|
plant   121 KTPDEIRAHFNIENDLTAEEVAKIREENQW 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 68/160 (43%)
Skp1 1..110 CDD:214704 42/106 (40%)
Skp1 84..158 CDD:279768 40/80 (50%)
SK5NP_567091.1 BTB_POZ_SKP1 4..112 CDD:349631 53/120 (44%)
Skp1 99..151 CDD:396171 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.980

Return to query results.
Submit another query.