DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SK13

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_567090.1 Gene:SK13 / 825171 AraportID:AT3G60010 Length:154 Species:Arabidopsis thaliana


Alignment Length:159 Identity:72/159 - (45%)
Similarity:100/159 - (62%) Gaps:15/159 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IIRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYH--KD 65
            ::.|.|:|.|.|..::.:|..|:||...|||  |...|.| |:.||..:||.||:.:...|  .|
plant     4 MVMLLSSDGESFQVEEAVAVQSQTIAHMIED--DCVANGV-PIANVTGVILSKVIEYCKKHVVSD 65

  Fly    66 DPVVTEEVENKEKRTDDISSWDADFLKV--DQGTLFELILAANYLNIQGLLDVTCKTVANMIKGK 128
            .|  |||.:      |::..|||:|:|.  ...|||:::||||||||:.|||:.|:|||:||.||
plant    66 SP--TEESK------DELKKWDAEFMKALEQSSTLFDVMLAANYLNIKDLLDLGCQTVADMITGK 122

  Fly   129 SPQAIRDTFAIQNDFLPQEEEQVRKENEW 157
            .|..||....|:|||.|:|||::||||:|
plant   123 KPDEIRALLGIENDFTPEEEEEIRKENQW 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 72/159 (45%)
Skp1 1..110 CDD:214704 43/110 (39%)
Skp1 84..158 CDD:279768 43/76 (57%)
SK13NP_567090.1 BTB_POZ_SKP1 4..119 CDD:349631 52/125 (42%)
Skp1 105..152 CDD:396171 27/47 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.