DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SK6

DIOPT Version :10

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_566978.1 Gene:SK6 / 824472 AraportID:AT3G53060 Length:85 Species:Arabidopsis thaliana


Alignment Length:87 Identity:40/87 - (45%)
Similarity:56/87 - (64%) Gaps:15/87 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EDLGDESDNSVLPLPNVNSLILKKVLHWATYHKDDPVVTEEVENKEKRTDDISSWDADFL-KVDQ 95
            ||  |.:||.: |||||.|.||..|:.:...|        .||:||   :|:..|||:|: |::|
plant     8 ED--DCADNGI-PLPNVTSKILLLVIEYCKKH--------VVESKE---EDLKKWDAEFMKKMEQ 58

  Fly    96 GTLFELILAANYLNIQGLLDVT 117
            ..||::::||||||||.|||:|
plant    59 SILFDVMMAANYLNIQSLLDLT 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 BTB_POZ_SKP1 3..125 CDD:349631 40/87 (46%)
Skp1 111..158 CDD:460222 5/7 (71%)
SK6NP_566978.1 BTB_POZ 2..80 CDD:453885 39/85 (46%)

Return to query results.
Submit another query.