DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SK9

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_566694.1 Gene:SK9 / 821739 AraportID:AT3G21850 Length:153 Species:Arabidopsis thaliana


Alignment Length:154 Identity:63/154 - (40%)
Similarity:92/154 - (59%) Gaps:9/154 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKDDPV 68
            |.|:|:|...|:.::|.|:..:.| ||.....|.:||.: |||||...||..|:.:...|..|..
plant     6 IILKSSDGHSFEVEEEAARQCQII-IAHMSENDCTDNGI-PLPNVTGKILAMVIEYCNKHHVDAA 68

  Fly    69 VTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGKSPQAI 133
                   .....||:..||.:|::.|..|:|:||.|||||||:.|.|:.|:|||.:|||.:|:.|
plant    69 -------NPCSDDDLKKWDKEFMEKDTSTIFDLIKAANYLNIKSLFDLACQTVAEIIKGNTPEQI 126

  Fly   134 RDTFAIQNDFLPQEEEQVRKENEW 157
            |:.|.|:||..|:||..:|:||:|
plant   127 REFFNIENDLTPEEEAAIRRENKW 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 63/154 (41%)
Skp1 1..110 CDD:214704 38/105 (36%)
Skp1 84..158 CDD:279768 38/74 (51%)
SK9NP_566694.1 BTB_POZ_SKP1 5..118 CDD:349631 46/120 (38%)
Skp1 104..151 CDD:366656 23/47 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.930

Return to query results.
Submit another query.