DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SK7

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_566693.1 Gene:SK7 / 821738 AraportID:AT3G21840 Length:125 Species:Arabidopsis thaliana


Alignment Length:125 Identity:43/125 - (34%)
Similarity:71/125 - (56%) Gaps:16/125 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKDD-- 66
            |.|:|:|.::|:.::|.|:..:||...||   .|..::|:|:.||.|.||:.|:.:...|..|  
plant     6 IMLKSSDGKMFEIEEETARQCQTIAHMIE---AECTDNVIPVSNVTSEILEMVIEYCNKHHVDAA 67

  Fly    67 -PVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMI 125
             |...|          |:..||.:|::.||.|:|.|:.||..|:|:.||.:..:|||:|:
plant    68 NPCSDE----------DLKKWDKEFMEKDQYTIFHLMNAAYDLHIKSLLALAYQTVADMV 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 43/125 (34%)
Skp1 1..110 CDD:214704 36/108 (33%)
Skp1 84..158 CDD:279768 18/42 (43%)
SK7NP_566693.1 BTB_POZ_SKP1 5..117 CDD:349631 42/123 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.