DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SK8

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_566692.1 Gene:SK8 / 821737 AraportID:AT3G21830 Length:152 Species:Arabidopsis thaliana


Alignment Length:154 Identity:56/154 - (36%)
Similarity:92/154 - (59%) Gaps:10/154 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKDDPV 68
            |.|:|::.:.|:.::|.|:..:||...||  .:.:||.:|.| .:.|.||:.|:.:...|..|..
plant     6 IMLKSSEGKTFEIEEETARQCQTIAHMIE--AECTDNVILVL-KMTSEILEMVIEYCNKHHVDAA 67

  Fly    69 VTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGKSPQAI 133
                   .....||:..||.:|::.|:.|:|.|..|||:||.:.||.:..:|||:||||.:|:.:
plant    68 -------NPCSDDDLEKWDKEFMEKDKSTIFALTNAANFLNNKSLLHLAGQTVADMIKGNTPKQM 125

  Fly   134 RDTFAIQNDFLPQEEEQVRKENEW 157
            |:.|.|:||..|:||..:|:||:|
plant   126 REFFNIENDLTPEEEAAIRRENKW 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 56/154 (36%)
Skp1 1..110 CDD:214704 33/105 (31%)
Skp1 84..158 CDD:279768 34/74 (46%)
SK8NP_566692.1 SKP1 3..150 CDD:227528 56/154 (36%)
Skp1 4..101 CDD:214704 32/104 (31%)
Skp1 77..150 CDD:279768 34/73 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.