DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SK3

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_565604.1 Gene:SK3 / 817111 AraportID:AT2G25700 Length:163 Species:Arabidopsis thaliana


Alignment Length:162 Identity:74/162 - (45%)
Similarity:102/162 - (62%) Gaps:15/162 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IIRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKD-- 65
            :|.|:|:|.|.|:.::.:|..|:||:..|||  |..||.: |||||...||.||:.:...|.:  
plant     7 MIILKSSDGESFEVEEAVAVESQTIKHMIED--DCVDNGI-PLPNVTGAILAKVIEYCKKHVEAA 68

  Fly    66 -----DPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMI 125
                 |.......||.|.:|     ||.||:|||..|||:|:.|||||||.||||:|||.||:.:
plant    69 AEAGGDKDFYGSTENHELKT-----WDNDFVKVDHPTLFDLLRAANYLNISGLLDLTCKAVADQM 128

  Fly   126 KGKSPQAIRDTFAIQNDFLPQEEEQVRKENEW 157
            :||:|..:|:.|.|:||:.|:||.:||.||.|
plant   129 RGKTPAQMREHFNIKNDYTPEEEAEVRNENRW 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 74/162 (46%)
Skp1 1..110 CDD:214704 47/113 (42%)
Skp1 84..158 CDD:279768 43/74 (58%)
SK3NP_565604.1 BTB_POZ_SKP1 7..128 CDD:349631 58/128 (45%)
Skp1 115..161 CDD:396171 25/46 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.930

Return to query results.
Submit another query.