DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and MEO

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_565467.1 Gene:MEO / 816536 AraportID:AT2G20160 Length:150 Species:Arabidopsis thaliana


Alignment Length:155 Identity:56/155 - (36%)
Similarity:93/155 - (60%) Gaps:14/155 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKDDPV 68
            |.|.|:|.|.|:.|:.:|:..:.:...|:|  |.:|.:: .|.||...||..::.:...|.||  
plant     6 IVLTSSDDECFEIDEAVARKMQMVAHMIDD--DCADKAI-RLQNVTGKILAIIIEYCKKHVDD-- 65

  Fly    69 VTEEVENKEKRTDDISSWDADFLK-VDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGKSPQA 132
                ||.|    ::..:|||:|:| :|..|||:|:.||:||.:.||.::..:.:|:....|:...
plant    66 ----VEAK----NEFVTWDAEFVKNIDMDTLFKLLDAADYLIVIGLKNLIAQAIADYTADKTVNE 122

  Fly   133 IRDTFAIQNDFLPQEEEQVRKENEW 157
            ||:.|.|:||:.|:|||::||:|||
plant   123 IRELFNIENDYTPEEEEELRKKNEW 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 56/155 (36%)
Skp1 1..110 CDD:214704 37/106 (35%)
Skp1 84..158 CDD:279768 33/75 (44%)
MEONP_565467.1 BTB_POZ_SKP1 5..114 CDD:349631 40/120 (33%)
Skp1 102..148 CDD:396171 19/46 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.