DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SK16

DIOPT Version :10

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_565297.1 Gene:SK16 / 814848 AraportID:AT2G03190 Length:170 Species:Arabidopsis thaliana


Alignment Length:167 Identity:67/167 - (40%)
Similarity:103/167 - (61%) Gaps:14/167 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKDDPV 68
            |.|.|:|.|.|:.::.:|:..:.|...|:|  |.:|.:: ||.||...||..|:.:...|..|.|
plant     6 IVLTSSDDESFEVEEAVARKLKVIAHMIDD--DCADKAI-PLENVTGNILALVIEYCKKHVLDDV 67

  Fly    69 --------VTEEVENKEKRTDDISSWDADFLK-VDQGTLFELILAANYLNIQGLLDVTCKTVANM 124
                    .|.|..|:|.: :::.:|||:|:| .|..|:.:||||.||||:|.||.:||:|||:.
plant    68 DDSDDSTEATSENVNEEAK-NELRTWDAEFMKEFDMETVMKLILAVNYLNVQDLLGLTCQTVADH 131

  Fly   125 IKGKSPQAIRDTFAIQNDFLPQEEEQVRKENEWC-ED 160
            :|..||:.:|:.|.|:||:.|:||:.:||||.|. ||
plant   132 MKDMSPEEVRELFNIENDYTPEEEDAIRKENAWAFED 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 BTB_POZ_SKP1 3..125 CDD:349631 49/129 (38%)
Skp1 111..158 CDD:460222 23/46 (50%)
SK16NP_565297.1 BTB_POZ_SKP1 5..132 CDD:349631 49/129 (38%)
Skp1 118..165 CDD:460222 23/46 (50%)

Return to query results.
Submit another query.