DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SK14

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_565296.1 Gene:SK14 / 814846 AraportID:AT2G03170 Length:149 Species:Arabidopsis thaliana


Alignment Length:155 Identity:67/155 - (43%)
Similarity:98/155 - (63%) Gaps:15/155 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKDDPV 68
            |.|.|:|.|.|:.::.:|:..:.:...||   |:...:.:||.||...||..|:.:...|    |
plant     6 IVLSSSDGESFEVEEAVARKLKIVEHMIE---DDCVVTEVPLQNVTGKILSIVVEYCKKH----V 63

  Fly    69 VTEEVENKEKRTDDISSWDADFL-KVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGKSPQA 132
            |.||       :|:..:||.:|: |.||.|:|:|:||||||||:||||::.:|||:.||.|:|:.
plant    64 VDEE-------SDEFKTWDEEFMKKFDQPTVFQLLLAANYLNIKGLLDLSAQTVADRIKDKTPEE 121

  Fly   133 IRDTFAIQNDFLPQEEEQVRKENEW 157
            ||:.|.|:|||.|:||..|||||.|
plant   122 IREIFNIENDFTPEEEAAVRKENAW 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 67/155 (43%)
Skp1 1..110 CDD:214704 38/106 (36%)
Skp1 84..158 CDD:279768 44/75 (59%)
SK14NP_565296.1 SKP1 3..147 CDD:227528 67/155 (43%)
Skp1 3..99 CDD:214704 38/106 (36%)
Skp1 72..147 CDD:279768 44/75 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.