DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SK19

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_565295.1 Gene:SK19 / 814845 AraportID:AT2G03160 Length:200 Species:Arabidopsis thaliana


Alignment Length:185 Identity:71/185 - (38%)
Similarity:102/185 - (55%) Gaps:34/185 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYH---KD 65
            |.|.|:|.|.|..::.:|:..:.:...|||  |.:.|.: |:|||...||.||:.:...|   .|
plant     6 IVLTSSDGESFKVEEVVARKLQIVGHIIED--DCATNKI-PIPNVTGEILAKVIEYCKKHVEDDD 67

  Fly    66 DPVVTEE--------VENKEKRTDDI-------------------SSWDADFLK-VDQGTLFELI 102
            |.|.|.|        ||..:|:.||:                   :.|||.|:| .|..|:|::|
plant    68 DVVETHESSTKGDKTVEEAKKKPDDVAVPESTEGDDEAEDKKEKLNEWDAKFMKDFDIKTIFDII 132

  Fly   103 LAANYLNIQGLLDVTCKTVANMIKGKSPQAIRDTFAIQNDFLPQEEEQVRKENEW 157
            |||||||:|||.|:..||:|:.||..:|:.:|:.|.|:|||.|:|||.:|.||.|
plant   133 LAANYLNVQGLFDLCSKTIADYIKDMTPEEVRELFNIENDFTPEEEEAIRNENAW 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 71/185 (38%)
Skp1 1..110 CDD:214704 46/136 (34%)
Skp1 84..158 CDD:279768 40/75 (53%)
SK19NP_565295.1 Skp1 3..140 CDD:214704 46/136 (34%)
SKP1 5..187 CDD:227528 70/183 (38%)
Skp1 114..187 CDD:279768 39/72 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.