DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SKP1

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_733779.1 Gene:SKP1 / 6500 HGNCID:10899 Length:163 Species:Homo sapiens


Alignment Length:163 Identity:113/163 - (69%)
Similarity:134/163 - (82%) Gaps:2/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPIIRLESADKEIFDTDQEIAKCSETIRIAIEDLG--DESDNSVLPLPNVNSLILKKVLHWATYH 63
            ||.|:|:|:|.|||:.|.||||.|.||:..:||||  ||.|:..:||||||:.|||||:.|.|:|
Human     1 MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHH 65

  Fly    64 KDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGK 128
            ||||...|:.||||||||||..||.:|||||||||||||||||||:|:|||||||||||||||||
Human    66 KDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGK 130

  Fly   129 SPQAIRDTFAIQNDFLPQEEEQVRKENEWCEDK 161
            :|:.||.||.|:|||..:||.||||||:|||:|
Human   131 TPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 112/161 (70%)
Skp1 1..110 CDD:214704 74/110 (67%)
Skp1 84..158 CDD:279768 56/73 (77%)
SKP1NP_733779.1 BTB_POZ_SKP1 4..127 CDD:349631 85/122 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..83 13/19 (68%)
Interaction with the F-box domain of F-box proteins. /evidence=ECO:0000250 104..163 45/58 (78%)
Skp1 113..160 CDD:396171 34/46 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149266
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - otm41331
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.720

Return to query results.
Submit another query.