DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and skp1

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001016519.1 Gene:skp1 / 549273 XenbaseID:XB-GENE-919631 Length:163 Species:Xenopus tropicalis


Alignment Length:163 Identity:113/163 - (69%)
Similarity:134/163 - (82%) Gaps:2/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPIIRLESADKEIFDTDQEIAKCSETIRIAIEDLG--DESDNSVLPLPNVNSLILKKVLHWATYH 63
            ||.|:|:|:|.|||:.|.||||.|.||:..:||||  ||.|:..:||||||:.|||||:.|.|:|
 Frog     1 MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHH 65

  Fly    64 KDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGK 128
            ||||...|:.||||||||||..||.:|||||||||||||||||||:|:|||||||||||||||||
 Frog    66 KDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGK 130

  Fly   129 SPQAIRDTFAIQNDFLPQEEEQVRKENEWCEDK 161
            :|:.||.||.|:|||..:||.||||||:|||:|
 Frog   131 TPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 112/161 (70%)
Skp1 1..110 CDD:214704 74/110 (67%)
Skp1 84..158 CDD:279768 56/73 (77%)
skp1NP_001016519.1 BTB_POZ_SKP1 4..127 CDD:349631 85/122 (70%)
Skp1 113..160 CDD:396171 34/46 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - otm48533
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.110

Return to query results.
Submit another query.