DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SkpF

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_611796.1 Gene:SkpF / 37713 FlyBaseID:FBgn0034863 Length:171 Species:Drosophila melanogaster


Alignment Length:157 Identity:87/157 - (55%)
Similarity:114/157 - (72%) Gaps:1/157 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPIIRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDN-SVLPLPNVNSLILKKVLHWATYHK 64
            ||:|:|:|:|.|||:||.|.||||.||:..:||...|::| :::|||||||.||||||.||.:|:
  Fly     1 MPVIKLQSSDGEIFETDIETAKCSSTIKTLLEDCPVEAENDTLIPLPNVNSTILKKVLIWAKHHR 65

  Fly    65 DDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGKS 129
            :|.....|.|..:.....|:.|||:||.:|||||||||||||||:|..||:..|.||||||||::
  Fly    66 EDIAEENEEEAAKSVAVQITPWDAEFLSMDQGTLFELILAANYLDIPNLLNAACMTVANMIKGRT 130

  Fly   130 PQAIRDTFAIQNDFLPQEEEQVRKENE 156
            .:.||.||.|.|||.|.||:.:..|:|
  Fly   131 TEEIRQTFHITNDFSPSEEDLMTMESE 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 87/157 (55%)
Skp1 1..110 CDD:214704 62/109 (57%)
Skp1 84..158 CDD:279768 45/73 (62%)
SkpFNP_611796.1 SKP1 1..157 CDD:227528 86/155 (55%)
Skp1 1..111 CDD:214704 62/109 (57%)
Skp1 87..157 CDD:279768 44/69 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452342
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - otm46619
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
1110.850

Return to query results.
Submit another query.