DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SkpD

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster


Alignment Length:155 Identity:77/155 - (49%)
Similarity:108/155 - (69%) Gaps:3/155 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PIIRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESD-NSVLPLPNVNSLILKKVLHWATYHKD 65
            |.|:|||:|..||.|:.:.||.||||:..:|....|:| |:|:|||.||:.||.|:|.||.:|||
  Fly     4 PTIKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENAVVPLPKVNAFILNKILTWAYHHKD 68

  Fly    66 DPVVTEEVENKEKRT-DDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGKS 129
            |.....|.|....:: .|||.|||:|:.|||..|||:.:|||||.|:||.|:.|||:||||:||:
  Fly    69 DDDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTLANMIRGKT 133

  Fly   130 PQAIRDTFAIQNDFLPQEEEQVRKE 154
            |:.||.||.|::| ||.:..::.::
  Fly   134 PEEIRQTFNIEDD-LPIDTAELGED 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 77/155 (50%)
Skp1 1..110 CDD:214704 55/109 (50%)
Skp1 84..158 CDD:279768 38/71 (54%)
SkpDNP_608357.2 Skp1 6..114 CDD:214704 54/107 (50%)
Skp1 88..>147 CDD:279768 36/59 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452343
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - otm46619
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
1110.850

Return to query results.
Submit another query.