DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and SPBC1861.07

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_596724.1 Gene:SPBC1861.07 / 2539714 PomBaseID:SPBC1861.07 Length:97 Species:Schizosaccharomyces pombe


Alignment Length:106 Identity:29/106 - (27%)
Similarity:49/106 - (46%) Gaps:17/106 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRLESADKEIFDTDQEIAKCSETIR-IAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKDDP 67
            :||.|.|..:|..::|||..|.||| |..|.:..|:..:....|::.:.:|:||..:..|:    
pombe     6 VRLISGDGFVFILEKEIACLSGTIRAILNEGIFSEAQKNECTFPDIRATLLEKVCEYLHYN---- 66

  Fly    68 VVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYL 108
                   .:.|...||..:|     :....:.||::.|.||
pombe    67 -------YRYKNQLDIPKFD-----IPPEMVLELLVTAEYL 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 29/106 (27%)
Skp1 1..110 CDD:214704 29/106 (27%)
Skp1 84..158 CDD:279768 6/25 (24%)
SPBC1861.07NP_596724.1 Skp1 3..96 CDD:214704 29/106 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.