DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and skr-4

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_507857.1 Gene:skr-4 / 191762 WormBaseID:WBGene00004810 Length:159 Species:Caenorhabditis elegans


Alignment Length:158 Identity:76/158 - (48%)
Similarity:108/158 - (68%) Gaps:9/158 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWATYHKDD-P 67
            |:|.|:|.:.|...:::...|:||.      |..|:::: |||.|.|.||:|::.|..:|.|| |
 Worm    10 IKLISSDDKTFTVSRKVISQSKTIS------GFTSEDTI-PLPKVTSAILEKIITWCEHHADDEP 67

  Fly    68 VVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGKSPQA 132
            ...|::|...|:|.:||.|||:|:|||||||||:|||||||:|:|||:||.:.||||:|||:|..
 Worm    68 KKVEKIEKGNKKTVEISEWDAEFMKVDQGTLFEIILAANYLDIRGLLEVTTQNVANMMKGKTPSQ 132

  Fly   133 IRDTFAIQNDFLPQEEEQVRKENEWCED 160
            :|..|.|.| |..:|.|.::|.|.||||
 Worm   133 VRTLFKIDN-FSEEELEAMKKGNAWCED 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 76/158 (48%)
Skp1 1..110 CDD:214704 49/106 (46%)
Skp1 84..158 CDD:279768 44/73 (60%)
skr-4NP_507857.1 Skp1 7..110 CDD:214704 49/106 (46%)
SKP1 10..159 CDD:227528 74/156 (47%)
Skp1 84..157 CDD:279768 44/73 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160690
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.770

Return to query results.
Submit another query.