DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and skr-19

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_510193.4 Gene:skr-19 / 181446 WormBaseID:WBGene00004825 Length:155 Species:Caenorhabditis elegans


Alignment Length:157 Identity:52/157 - (33%)
Similarity:77/157 - (49%) Gaps:25/157 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PII--RLESADKEIFDTDQE----IAKCSETIRIAIEDL--GDESDNSVLPLPNVNSLILKKVLH 58
            |:|  :|.|.|.:.|..|:.    |.:..:..|.|..||  .|:.....|.:|   :.:::||:.
 Worm     6 PVILYKLRSTDGQRFLADRRTIGMIGRIEDLFRNAGLDLIPADQLQPIQLEIP---ATVMRKVIE 67

  Fly    59 WATYHKDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVAN 123
            |..:||.||...|    .|..|:||..|||.||.|....||::|.||....:.||..:.|:.|  
 Worm    68 WCDHHKHDPPYDE----SEPETNDIPDWDASFLMVRHNMLFDIIRAARDFTVPGLFAMCCRVV-- 126

  Fly   124 MIKGKSPQAIRDTFAIQNDFLPQEEEQ 150
               |::|:.|.|  .:.||   :||||
 Worm   127 ---GQNPREIID--GLVND---EEEEQ 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 52/157 (33%)
Skp1 1..110 CDD:214704 38/115 (33%)
Skp1 84..158 CDD:279768 25/67 (37%)
skr-19NP_510193.4 BTB_POZ_SKP1 9..129 CDD:349631 41/131 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.