DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and skr-3

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_507059.1 Gene:skr-3 / 180081 WormBaseID:WBGene00004809 Length:167 Species:Caenorhabditis elegans


Alignment Length:162 Identity:82/162 - (50%)
Similarity:110/162 - (67%) Gaps:9/162 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNS----VLPLPNVNSLILKKVLHWATYHK 64
            |:|.|:|.:.|...:::...|:||...|::||.|...|    .:||..|.|.||:|::.|..:|.
 Worm    10 IKLTSSDDKTFTVSRKVISQSKTITDIIQNLGIEESGSTSEDTIPLQKVTSTILEKIITWCEHHA 74

  Fly    65 DD-PVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGK 128
            || |...:|    .|:|.|||.|||:|:|||||||||:|||||||:|:||||||.:.||||:|||
 Worm    75 DDEPKKVDE----NKKTVDISEWDAEFMKVDQGTLFEIILAANYLDIRGLLDVTTQNVANMMKGK 135

  Fly   129 SPQAIRDTFAIQNDFLPQEEEQVRKENEWCED 160
            :|..||..|.|:|||..:|.|.::|||.||||
 Worm   136 TPSQIRTLFNIENDFSEEEREAMKKENAWCED 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 82/162 (51%)
Skp1 1..110 CDD:214704 51/110 (46%)
Skp1 84..158 CDD:279768 48/73 (66%)
skr-3NP_507059.1 Skp1 7..117 CDD:214704 51/110 (46%)
SKP1 10..167 CDD:227528 80/160 (50%)
Skp1 91..165 CDD:279768 48/73 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160677
Domainoid 1 1.000 56 1.000 Domainoid score I7318
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.