DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and skr-14

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_504220.4 Gene:skr-14 / 178839 WormBaseID:WBGene00004820 Length:168 Species:Caenorhabditis elegans


Alignment Length:142 Identity:54/142 - (38%)
Similarity:77/142 - (54%) Gaps:13/142 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EIFDTDQEIAKCSE-------TIRIAIEDLGDESDN----SVLPLPNVNSLILKKVLHWATYHKD 65
            :|...|..:.|.||       |:...||:||...:|    ..:|:.|||...::||..|...|..
 Worm    16 KIISNDGVVTKMSEKAVQQSKTLSNLIENLGYTIENIETRDPIPVTNVNGKTMEKVAEWCEKHNA 80

  Fly    66 DPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGKSP 130
            | .:.|:..|..| |..|..||..|||::...||:||||:|:|:|:||:...||||:||.|||:.
 Worm    81 D-AIPEDNMNVLK-TLTIPEWDQKFLKIEDEALFDLILASNFLDIKGLMYYGCKTVSNMAKGKTT 143

  Fly   131 QAIRDTFAIQND 142
            ..:|:.|.|..|
 Worm   144 AELREIFGINTD 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 54/142 (38%)
Skp1 1..110 CDD:214704 38/108 (35%)
Skp1 84..158 CDD:279768 29/59 (49%)
skr-14NP_504220.4 Skp1 12..123 CDD:214704 38/108 (35%)
Skp1 97..161 CDD:279768 29/59 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160682
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.