DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and skr-12

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001367151.1 Gene:skr-12 / 178496 WormBaseID:WBGene00004818 Length:172 Species:Caenorhabditis elegans


Alignment Length:165 Identity:60/165 - (36%)
Similarity:89/165 - (53%) Gaps:15/165 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PIIRLESAD--KEIFDTDQEIAKCSE-------TIRIAIEDLGDESDN----SVLPLPNVNSLIL 53
            ||:...:|:  .:|..:|..::|.||       |:...||:||...:|    ..:|:.|||...:
 Worm     4 PIVDAPAAEIVYKIISSDGVVSKMSEKAVQQSKTLSNLIENLGYTIENIETRDPIPVTNVNGKTM 68

  Fly    54 KKVLHWATYHKDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTC 118
            .||..|...||.| .:.|:..|..| |..|..||..|||::...||:||||:|:|:|:||:...|
 Worm    69 AKVAEWCEKHKAD-AIPEDNMNVLK-TLTIPEWDQKFLKIEDEALFDLILASNFLDIKGLMYFGC 131

  Fly   119 KTVANMIKGKSPQAIRDTFAIQNDFLPQEEEQVRK 153
            |||:||.|||:...:|:.|.|..|.....||..::
 Worm   132 KTVSNMAKGKTTAELREIFGINTDEQDAAEETAQR 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 60/165 (36%)
Skp1 1..110 CDD:214704 42/120 (35%)
Skp1 84..158 CDD:279768 31/70 (44%)
skr-12NP_001367151.1 BTB_POZ_SKP1 14..138 CDD:349631 47/125 (38%)
Skp1 124..161 CDD:396171 15/36 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160685
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.