DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and skr-13

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_503042.1 Gene:skr-13 / 178493 WormBaseID:WBGene00004819 Length:172 Species:Caenorhabditis elegans


Alignment Length:155 Identity:55/155 - (35%)
Similarity:85/155 - (54%) Gaps:6/155 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IIRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDN----SVLPLPNVNSLILKKVLHWATYH 63
            :.::.|:|..:....::..:.|:|:...||:||...:|    ..:|:.|||...:.||......|
 Worm    14 VYKIISSDGVVSKMSEKAVQQSKTLSNLIENLGYTIENIETRDPIPVTNVNGKTMAKVAELCEKH 78

  Fly    64 KDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGK 128
            |.| .:.|:..|..| |..|..||..|||::...||:||||:|:|:|:||:...||||:||.|||
 Worm    79 KAD-AIPEDNMNVLK-TLTIPEWDQKFLKIEDEALFDLILASNFLDIKGLMYYGCKTVSNMAKGK 141

  Fly   129 SPQAIRDTFAIQNDFLPQEEEQVRK 153
            :...:|:.|.|..|.....||..:|
 Worm   142 TTAELREIFGINTDEQDAAEETAQK 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 55/155 (35%)
Skp1 1..110 CDD:214704 36/110 (33%)
Skp1 84..158 CDD:279768 32/70 (46%)
skr-13NP_503042.1 Skp1 12..123 CDD:214704 36/110 (33%)
SKP1 16..166 CDD:227528 54/151 (36%)
Skp1 97..161 CDD:279768 29/63 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160676
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.