DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and skr-17

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001379551.1 Gene:skr-17 / 174257 WormBaseID:WBGene00004823 Length:180 Species:Caenorhabditis elegans


Alignment Length:154 Identity:52/154 - (33%)
Similarity:82/154 - (53%) Gaps:13/154 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IIRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSV----LPLPNVNSLILKKVLHWATYH 63
            :::|.|:|..:...|......|.|:...|.:||.:.:...    :|:.||....||.::.|...|
 Worm    24 LLQLTSSDGHLLQGDIRALLLSSTLAATIRELGYDKEYCAELKPVPVNNVVGFTLKLLIEWCDKH 88

  Fly    64 K-DDPVVTEEVENKEKRTDDISSWDADFL-KVDQGTLFELILAANYLNIQGLLDVTCKTVANMIK 126
            | |||.:.  :..|:|:...|.|||..|| ::....||:||.||.:|::.||::..||||||..|
 Worm    89 KEDDPAIA--LAEKDKKNICIPSWDRHFLSRLPMSNLFDLITAAYHLDVTGLINYGCKTVANSAK 151

  Fly   127 GKSPQAIRDTFAIQNDFLPQEEEQ 150
            ||:.:.:|:.|.|     |:..||
 Worm   152 GKNAEEMRELFGI-----PEPWEQ 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 52/154 (34%)
Skp1 1..110 CDD:214704 35/112 (31%)
Skp1 84..158 CDD:279768 29/68 (43%)
skr-17NP_001379551.1 BTB_POZ_SKP1 24..150 CDD:349631 43/127 (34%)
Skp1 137..>166 CDD:396171 14/33 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160686
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.