DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and skr-15

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_494662.1 Gene:skr-15 / 173729 WormBaseID:WBGene00004821 Length:184 Species:Caenorhabditis elegans


Alignment Length:159 Identity:50/159 - (31%)
Similarity:83/159 - (52%) Gaps:10/159 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PII--RLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDN--SVLPLP--NVNSLILKKVLHWA 60
            |::  .:||.|:.:....::..|.|.|:..:|.:||..::|  |::|:|  .||...||.|:.|.
 Worm    17 PVVYYSIESNDRVVLKISEQAIKQSATLSNSITNLGYSAENAESMVPIPIEKVNGKTLKLVVEWC 81

  Fly    61 TYHKDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMI 125
            .:||.|||    .|........:..||..|:.::...|.:|:.|:|:|.:..||...||.:|.:.
 Worm    82 EHHKADPV----PEAYPSGNTVLPVWDRKFVDIEHDALTDLVNASNFLEVMTLLTYCCKFIAGLA 142

  Fly   126 KGKSPQAIRDTFAIQNDFLPQEEEQVRKE 154
            ||.||:.:|..|.|..|...::.|:..||
 Worm   143 KGMSPEEMRVFFCIPTDEEDEKAERFGKE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 50/159 (31%)
Skp1 1..110 CDD:214704 34/113 (30%)
Skp1 84..158 CDD:279768 24/71 (34%)
skr-15NP_494662.1 Skp1 20..127 CDD:214704 33/110 (30%)
SKP1 23..176 CDD:227528 49/153 (32%)
Skp1 101..167 CDD:279768 21/65 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160687
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.