DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpB and CG43089

DIOPT Version :9

Sequence 1:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001246606.1 Gene:CG43089 / 12798588 FlyBaseID:FBgn0262535 Length:144 Species:Drosophila melanogaster


Alignment Length:139 Identity:35/139 - (25%)
Similarity:67/139 - (48%) Gaps:13/139 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRLESADKEIFDTDQEIAK--CSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWAT--YHK 64
            |:|::.|..|...|...|.  |.....|..|...:...:.|:|||.|::..|:.::.|.|  .:.
  Fly     9 IQLQTNDGVIHTVDMRFALQICPVRNMIMQERQKNLHTDDVIPLPRVDAKNLRFIIKWWTSVQNL 73

  Fly    65 DDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMI-KGK 128
            |:.::|   ..|.|....:::..|     :...|.::||||:||.::..|.::...:|:.: :.:
  Fly    74 DENLLT---MGKRKLKQLLTAEHA-----NHQFLLQIILAADYLQMEKFLLISTHLMADALNECE 130

  Fly   129 SPQAIRDTF 137
            |.:.||..|
  Fly   131 SVEEIRRKF 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpBNP_610729.1 SKP1 1..161 CDD:227528 35/139 (25%)
Skp1 1..110 CDD:214704 29/109 (27%)
Skp1 84..158 CDD:279768 14/55 (25%)
CG43089NP_001246606.1 BTB 9..111 CDD:295341 29/109 (27%)
Skp1 95..>139 CDD:279768 12/43 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.