powered by:
Protein Alignment jeb and hen-1
DIOPT Version :9
Sequence 1: | NP_001260910.1 |
Gene: | jeb / 36295 |
FlyBaseID: | FBgn0086677 |
Length: | 560 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_509200.1 |
Gene: | hen-1 / 191666 |
WormBaseID: | WBGene00001841 |
Length: | 117 |
Species: | Caenorhabditis elegans |
Alignment Length: | 54 |
Identity: | 19/54 - (35%) |
Similarity: | 28/54 - (51%) |
Gaps: | 2/54 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 489 CPTAMDGMERFACPIPDRQG--RYRCIDDHVLCDGFIDCPDGEDEDRRSCMFYK 540
|.|...|.:...|||.|... .:.||....||:|..|||:|:||:...|.:::
Worm 45 CETDRHGNKYIPCPIHDINDPRNWPCIKLADLCNGKADCPNGDDENYFQCFYHR 98
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
jeb | NP_001260910.1 |
LDLa |
499..532 |
CDD:238060 |
14/34 (41%) |
hen-1 | NP_509200.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160160163 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0012743 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR21105 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.940 |
|
Return to query results.
Submit another query.