DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jeb and hen-1

DIOPT Version :9

Sequence 1:NP_001260910.1 Gene:jeb / 36295 FlyBaseID:FBgn0086677 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_509200.1 Gene:hen-1 / 191666 WormBaseID:WBGene00001841 Length:117 Species:Caenorhabditis elegans


Alignment Length:54 Identity:19/54 - (35%)
Similarity:28/54 - (51%) Gaps:2/54 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 CPTAMDGMERFACPIPDRQG--RYRCIDDHVLCDGFIDCPDGEDEDRRSCMFYK 540
            |.|...|.:...|||.|...  .:.||....||:|..|||:|:||:...|.:::
 Worm    45 CETDRHGNKYIPCPIHDINDPRNWPCIKLADLCNGKADCPNGDDENYFQCFYHR 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jebNP_001260910.1 LDLa 499..532 CDD:238060 14/34 (41%)
hen-1NP_509200.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012743
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21105
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.