DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jeb and T14E8.2

DIOPT Version :9

Sequence 1:NP_001260910.1 Gene:jeb / 36295 FlyBaseID:FBgn0086677 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_509103.2 Gene:T14E8.2 / 188498 WormBaseID:WBGene00020505 Length:244 Species:Caenorhabditis elegans


Alignment Length:100 Identity:32/100 - (32%)
Similarity:41/100 - (41%) Gaps:18/100 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 PISHSIASQL---MLRTARGQRQYDVPQIECPTAMDGMERFACPIPDRQG---RYRCIDDHVLCD 520
            |..|..|.|:   :|.|:......:.|:...|    |.:..|||..|...   :..||:...|||
 Worm    34 PRRHKRAEQVRPPLLSTSPFMLWKNDPKCMIP----GRDMMACPKKDPNDPLEKLVCIEPSALCD 94

  Fly   521 GFIDCPDGEDEDRRSCMFYKTTKAHLDVLADALLR 555
            ...||...||||...|||.|        |.||.:|
 Worm    95 DHRDCHGAEDEDPHFCMFKK--------LEDAAMR 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jebNP_001260910.1 LDLa 499..532 CDD:238060 13/35 (37%)
T14E8.2NP_509103.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_121005
Panther 1 1.100 - - O PTHR21105
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.