DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and RDH16

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_003699.3 Gene:RDH16 / 8608 HGNCID:29674 Length:317 Species:Homo sapiens


Alignment Length:305 Identity:94/305 - (30%)
Similarity:148/305 - (48%) Gaps:45/305 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VWFALAT-VGAVLFYHF-----VKVSASGKGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIE 131
            :|..||. ||.....|:     |......|.|.||||::.....||::||..|..|.|...|   
Human     1 MWLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDARGLRVLAACLT--- 62

  Fly   132 ESDEAKILKEVTSGRMKLLHLDVTSEKTILEAARYVSQHLPHGAEGLWSVVHCAHWIALG-ELEW 195
             ...|:.|:..||.|::.:.||||..:::..||::|.:.:..  :|||.:|:.|     | .|..
Human    63 -EKGAEQLRGQTSDRLETVTLDVTKTESVAAAAQWVKECVRD--KGLWGLVNNA-----GISLPT 119

  Fly   196 IPFAVLRKS-----LDLNLLGSARLTQIFLPLVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAV 255
            .|..:|.|.     ||:||||...:|...|||||||.||||.::|.:.|| |...|..|.::..|
Human   120 APNELLTKQDFVTILDVNLLGVIDVTLSLLPLVRRARGRVVNVSSVMGRV-SLFGGGYCISKYGV 183

  Fly   256 DCFAACLRQEMRTRGVDVSVVAAGEFAPGNGWLNETELRDQAK------QMWNQLSSEQKKTYGE 314
            :.|:..||:|:...||.|:::..|.|        :|.:..:.:      ::|::.|.|.|:.|||
Human   184 EAFSDSLRRELSYFGVKVAMIEPGYF--------KTAVTSKERFLKSFLEIWDRSSPEVKEAYGE 240

  Fly   315 ----DYYEAAMTSVEKYSRQAADIQPTLRVLIDAVTRTFPMARYT 355
                ||.::|....:|.::   |:......:..|:....|..||:
Human   241 KFVADYKKSAEQMEQKCTQ---DLSLVTNCMEHALIACHPRTRYS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 87/276 (32%)
adh_short 96..293 CDD:278532 71/202 (35%)
RDH16NP_003699.3 NADB_Rossmann 30..305 CDD:304358 87/276 (32%)
adh_short 30..218 CDD:278532 71/207 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 125 1.000 Domainoid score I5479
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 1 Normalized mean entropy S2603
OMA 1 1.010 - - QHG48608
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 1 1.000 - - otm41558
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR43313
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.